HIF1AN Rabbit Polyclonal Antibody TA331877 from OriGene Technologies | Biocompare.com

Supplier Images

HIF1AN Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HIF1AN Rabbit Polyclonal Antibody

The HIF1AN Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Human antigen. The HIF1AN Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-HIF1AN Antibody

Product Specs
ItemHIF1AN Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA331877
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetHIF1AN
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-HIF1AN Antibody: synthetic peptide directed towards the N terminal of human HIF1AN. Synthetic peptide located within the following region: EAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTN
NCBI Full Gene Namehypoxia inducible factor 1 subunit alpha inhibitor
NCBI Gene AliasesFIH1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!